SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049213 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049213
Domain Number 1 Region: 64-115
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.02e-18
Family Transcriptional factor domain 0.00021
Further Details:      
 
Domain Number 2 Region: 2-43
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000235
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049213   Gene: ENSCJAG00000014407   Transcript: ENSCJAT00000061802
Sequence length 117
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:6874155:6931849:-1 gene:ENSCJAG00000014407 transcript:ENSCJAT00000061802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQEMASDELKEMRKNLTKEA
IREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
Download sequence
Identical sequences A0A1D5RD77 A0A2I2YQZ4 A0A2I3GD09 A0A2I3ND24 A0A2I3SYU3 A0A2J8UN64 A0A2K5BVD5 A0A2K5JN66 A0A2K5N6Y8 A0A2K5VWC3 A0A2K5Y4R1 A0A2K6CEX6 A0A2K6N7V4 A0A2K6UQ52 B7Z4S1 F6WLS6
ENSCJAP00000049213 ENSP00000429192 ENSP00000429192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]