SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049285 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049285
Domain Number 1 Region: 367-481,601-747
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.72e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 9-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-52
Family L-arabinose binding protein-like 0.009
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000049285
Domain Number - Region: 495-598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0549
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049285   Gene: ENSCJAG00000001564   Transcript: ENSCJAT00000061157
Sequence length 862
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:34881662:35024263:-1 gene:ENSCJAG00000001564 transcript:ENSCJAT00000061157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTL
HVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS
AAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIG
KHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPG
AHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERA
LKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGND
TSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVG
DGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKK
PQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSE
STNEFGIFNSLWFSLGAFMQQGCDISPRSLSECIVEGEWWFFTLPMTSLYTANLAAFLTV
ERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTT
AEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAV
NLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLA
MLVALIEFCYKSRAEAKRMKKQHCLSPEMTLNDAMRSKARLSITGSTGENGRVLTPEFPK
AVHAVPYVSPGMGMNVSVTDLS
Download sequence
Identical sequences F6UA23
ENSCJAP00000049285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]