SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049465 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049465
Domain Number 1 Region: 103-248,324-393
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-31
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049465   Gene: ENSCJAG00000009878   Transcript: ENSCJAT00000053991
Sequence length 727
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:69070436:69120628:-1 gene:ENSCJAG00000009878 transcript:ENSCJAT00000053991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKQARSSAASQESREGLPEEEAPRPQLDLQASKKLPDLYGNPPRELIGEPLEDLDPFY
STQKTFIVLNKGKTIFRFSATNALYILSPFHPIRRAAVKILVHSLFSMLIMCTILTNCVF
MAQHDPPPWTKYVEYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSVIVMAYTT
EFVDLGNVSALRTFRVLRALKTISVISGLKTIVGALIQSVKKLADVMVLTVFCLSVFALI
GLQLFMGNLRHKCVRNFTALNGTNGSVEADGSVWESLDLYLSDPENYLLKNGTSDVLLCG
NSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGK
IYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHEA
LTIRGVDTVSRSSLEMSPLAPVTIHERRSKRRKRMSSGTEECGEDRLPKSDSEDGPRAVN
RLSLTHGLSRTSMKPRSSRGSIFTFRRRDLGSETDFADDENSTAGESESHHTSLLVPWPL
RRTGAQGQPNIGTAAPGHALNGKKNSTVDCNGVVSLVGAGDPEATPGSHLLRPVMLEHPL
DTTTPSEEPGGPRMLTPQAPCVDGFEEPEARQRALSAVSVLTSALEELEESQRKCPPCWN
RFAQRFLIWECCPLWISVKQGVKFVVTDPFADLTITMCIVLNTLFMALEHYNMTSEFEDM
LQVGNLV
Download sequence
Identical sequences F7AYU9
ENSCJAP00000049465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]