SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049938 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049938
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 2.77e-25
Family BTB/POZ domain 0.0037
Further Details:      
 
Domain Number 2 Region: 522-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000222
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 610-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000205
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 441-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000285
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 554-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000426
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 369-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000199
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049938   Gene: ENSCJAG00000005869   Transcript: ENSCJAT00000061433
Sequence length 657
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:56444135:56519489:1 gene:ENSCJAG00000005869 transcript:ENSCJAT00000061433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCS
VQGQVVRDVSTPSSEMFKKEPEKPQVETLSSEGAGEPNSSPEVSATPGGSVKAETEEAVH
AVSQEMSVNSPTAQESQRNAETPVETPNTAEVCSPSSAVQTSSEAKETNTEPAPNRKGEK
EVKGGPSEQEYSVTQADLKVVGKQLGEGDSREDNEKQRSLYKRWLGEETAKPLQAESSHS
HGQLTEGIARGAIWWSSDFCGNKERHSKGKMKNFVFVMCKKPLRLRECPQIFPRPAACHA
GVSRHCAKKSFVCKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKECSETKDSKKELEKHQ
LEAHGAGGEADIPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECGAKF
AANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDAVFAQS
IELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQDH
RKHIHEVHSKEYHPCPTCGKIFSAPSMLERHMVTHVGGKPFSCGICNKAYQKLSNYR
Download sequence
Identical sequences F7CQV2
ENSCJAP00000049938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]