SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050058 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050058
Domain Number 1 Region: 60-233,262-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.21e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050058   Gene: ENSCJAG00000020150   Transcript: ENSCJAT00000055141
Sequence length 391
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:95867239:95879680:1 gene:ENSCJAG00000020150 transcript:ENSCJAT00000055141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARKASRTGTLRPRAQKGRVRRAVRISSLVAQEVLSLGADVLPEYKLQAPRIHRWTILH
YSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPAAPDCGYACQPLAVVDLIVDIM
FIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIG
LLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHVDSR
IGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSI
CVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQCCDHPGP
WPHFHVPHVARQPPPPSHPGLAFSGFPVHGM
Download sequence
Identical sequences F7FD60
ENSCJAP00000050058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]