SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050073 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050073
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.63e-39
Family PDEase 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050073   Gene: ENSCJAG00000014554   Transcript: ENSCJAT00000062770
Sequence length 139
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:40641923:40913873:1 gene:ENSCJAG00000014554 transcript:ENSCJAT00000062770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLKQSILATDLTLYFERRTEFFELVSKGEYDWNIKIHRDIFRSMLMTACDLGAVTKPW
EISRQVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQNC
VPKNINIQPLSKSYLFKKS
Download sequence
Identical sequences F7FCX3
ENSCJAP00000050073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]