SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050148 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050148
Domain Number 1 Region: 11-299
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.1e-37
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 267-301,332-533
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000229
Family WD40-repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050148   Gene: ENSCJAG00000003036   Transcript: ENSCJAT00000054203
Sequence length 777
Comment pep:novel chromosome:C_jacchus3.2.1:17:16945572:17069026:1 gene:ENSCJAG00000003036 transcript:ENSCJAT00000054203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKISLLKEPKHIELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPI
DFHWFPKSLGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTA
LVTVGEDGQIKIWSKTGMLRSTLAHQGTPVYSVAWGPDSENVLFTAGKQLIIKPLQPNAK
VLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRLLYNSQPHEHPITSVAWSPD
GELFAVGSFHTLRLCDKTGWSYTLEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVE
QHWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFST
KNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQ
TVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIA
FIDKNRDLCIASVKRFGKEEQIIKLGTMVHTLAWNDACNILCGLQDTRFIVWYYPNTVYV
DRDILPNTLYERDASEFSKNPHIMSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSK
WEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKES
KMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAAKYKTHVDTVLAYRQ
KFLETFGKQETNKRFLHYAEGLQIDWEKIKAKIKMEITKEQEQSSNSQSSKNMGLKL
Download sequence
Identical sequences F7H4B5
ENSCJAP00000050148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]