SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050341 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050341
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000408
Family DNA polymerase processivity factor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050341   Gene: ENSCJAG00000014735   Transcript: ENSCJAT00000057232
Sequence length 280
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:15070943:15086164:-1 gene:ENSCJAG00000014735 transcript:ENSCJAT00000057232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRGKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFSEFQMEGFSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELF
SMSSSTRIATHDIPIKVIPRKLWKDLQEPMVPDPDVSIYLPVLKTMKSVVEKMKNISSHL
VIEANRDGELNLKIETELVCVTTHFKDLGNPPLASESTSQDRNPEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVTNKMVHFHLLHEDVSLQYFIPALS
Download sequence
Identical sequences F7G3C8
XP_002751451.1.60252 ENSCJAP00000027130 ENSCJAP00000050341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]