SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050432 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050432
Domain Number 1 Region: 13-489
Classification Level Classification E-value
Superfamily ALDH-like 9.56e-169
Family ALDH-like 0.00000000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050432   Gene: ENSCJAG00000004575   Transcript: ENSCJAT00000058121
Sequence length 493
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:40235557:40262032:1 gene:ENSCJAG00000004575 transcript:ENSCJAT00000058121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGTFVVSQPLNYRGGTRGAGGRSGTEKAFEPATGRVIATFTCSGEKEVNLAVQNAKAA
FKIWSQKSGMERCRILLEAARIIRERKDEIATVECINNGKSIFEARLDIDTSWQCLEYFA
GLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKP
SPFTPVSALLLAEIYTEAGVPPGLFNVVQGGVATGQFLCQHHDVAKVSFTGSVPTGMKIM
EMASKGVKPVTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEIL
DKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDTYV
PEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILPFDTEAEVLERANDTTFGLAA
GVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLK
TVCVEMGDVESAF
Download sequence
Identical sequences F7HJ99
ENSCJAP00000050432 ENSCJAP00000008358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]