SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050459 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050459
Domain Number 1 Region: 21-497
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-182
Family ALDH-like 0.00000000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050459   Gene: ENSCJAG00000017159   Transcript: ENSCJAT00000062996
Sequence length 501
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:7029814:7063652:-1 gene:ENSCJAG00000017159 transcript:ENSCJAT00000062996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSGLRPGFPTPEVDLKLEADEIFINNEWHESKSGKKFATYNPSTLEKICEVEEGDKPDV
DKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFF
IDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKM
APALCCGNTMVLKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQIN
KIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQG
QCCTAASRVFVEEQVYAEFVRRSVEYARKRPVGDPFDVKTEQGPQIDQKQFDKILELIES
GKKEGAKLECGGSAVEDRGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFRSIEEVIQR
ANSTDYGLTAAVFTKNLDKALTLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELGE
YALAEYTEVKTVTIKLGNKNP
Download sequence
Identical sequences F7H8Z1
ENSCJAP00000050459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]