SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050546 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050546
Domain Number 1 Region: 106-250
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.78e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 31-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000145
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050546   Gene: ENSCJAG00000020833   Transcript: ENSCJAT00000062826
Sequence length 253
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:58788482:58884467:1 gene:ENSCJAG00000020833 transcript:ENSCJAT00000062826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD
GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
Download sequence
Identical sequences F7EXF2 H2PYC1 Q6FIC5 Q9Y696
ENSPTRP00000000611 ENSCJAP00000050546 ENSP00000363500 ENSP00000436538 NP_039234.1.87134 NP_039234.1.92137 XP_001168510.2.37143 XP_002750479.1.60252 9606.ENSP00000363500 ENSP00000363500 ENSP00000436538 ENSCJAP00000038761 ENSP00000363500 gi|7330335|ref|NP_039234.1| ENSPTRP00000000611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]