SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050549 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050549
Domain Number 1 Region: 192-329
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 5.75e-44
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000386
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000050549
Domain Number - Region: 5-39
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.000235
Family MoCo biosynthesis proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050549   Gene: ENSCJAG00000008757   Transcript: ENSCJAT00000016990
Sequence length 332
Comment pep:novel chromosome:C_jacchus3.2.1:3:1827837:1828858:-1 gene:ENSCJAG00000008757 transcript:ENSCJAT00000016990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLQGQISFTTSVSEHLCGTCNHLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRI
IAVGRKKRQHAGMFSISQMKNRPMSLPHLFLMSHDSPTANPSISSWDALHVEGLRSRMSF
PSQMATLWKGCRVPRPPLAQQQLGSGSFQRHYTFDADSDANSKRLSPGSSASADPSGPQL
TSEQLTHVDSEGPAAMVDVGRKPDMERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQ
LAGVQLIPLCHHVALSHVQVQLALDSTRHAVETWASCQARGPTGVEMEALTSAAVAALTL
YDMCKAVSRDIVLEEIKLISKTAGQRGDFRQA
Download sequence
Identical sequences F7EXD1
ENSCJAP00000050549 ENSCJAP00000050549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]