SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051012 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051012
Domain Number 1 Region: 120-353
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.06e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 804-1053
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.94e-31
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 483-638,678-756
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051012
Domain Number - Region: 1058-1205
Classification Level Classification E-value
Superfamily EF-hand 0.00751
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051012   Gene: ENSCJAG00000007392   Transcript: ENSCJAT00000059560
Sequence length 1739
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:29511044:29622646:1 gene:ENSCJAG00000007392 transcript:ENSCJAT00000059560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSTEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRN
TSMPTSETESVNTENVSGEAETRGCCRSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSV
TFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYF
VSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASL
LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILT
GEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNT
AQKEEAEEKERKKIARKESLENKKNNKPEVNQVANSDNKVTIDDYREEDEDKDPYPPCDV
PGDGEEQEGFASYEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKL
INHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFG
AFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLK
HVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILY
KDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVY
NHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKA
RPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNM
VFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADGDVSSSRVSVTF
SLRGFRMMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVA
MKDNNQINRNNNFQTFPQAVLLLFRKRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYT
CGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDP
EAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALV
RTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQD
YFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEEAKREE
EDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGN
SVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDRE
PQRRSSVKRSDSGDEQLPTICREDPEVHGYFRDPRCLGEQEYFSSEECYEDDSSPTWSRQ
NYGYYSRYPGRNMDFERPRGYHQPQGFLEDDDSPICYDSRRSPRRRLLPPTPASHRRSSF
NFECLRRQSSQEEIPSSPTFFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWA
TPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLT
IPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKYEIADACDLTIDEMESA
ASTLLNGNVRPRANGDVGPLSHQQDYELQDFGPGYSDEEPDLGRDEEDLADEMICITTL
Download sequence
Identical sequences F7CIX9
ENSCJAP00000051012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]