SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051252 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051252
Domain Number 1 Region: 136-323
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.87e-50
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000256
Further Details:      
 
Domain Number 2 Region: 13-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.95e-38
Family DNA repair glycosylase, N-terminal domain 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051252   Gene: ENSCJAG00000016101   Transcript: ENSCJAT00000062838
Sequence length 408
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:61661228:61668739:1 gene:ENSCJAG00000016101 transcript:ENSCJAT00000062838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARGILPRRLGHRTLASAPAMWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDQSRAGRPTPDELEAVCKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPQLIQLDDVTYHG
FPSLQALAGPDVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLREASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHMWQIAQRDYSWHPTMSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQATPPSYRCYSVLTCVNPAVLRRHQQSAERVPKGRKTRWGALDKGI
PQAPSSPFPTSVSPSLPSLMLGRGLPATTSRARYPQAVCTTRLGGGYL
Download sequence
Identical sequences F6VKK9
ENSCJAP00000051252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]