SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051399 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051399
Domain Number 1 Region: 106-244
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-34
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 2 Region: 245-384
Classification Level Classification E-value
Superfamily C-type lectin-like 3.1e-33
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 3 Region: 393-520
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-19
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 4 Region: 50-106
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-16
Family Fibronectin type II module 0.0025
Further Details:      
 
Domain Number 5 Region: 532-598
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000388
Family C-type lectin domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051399
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.008
Family Cysteine rich domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051399   Gene: ENSCJAG00000014982   Transcript: ENSCJAT00000052324
Sequence length 602
Comment pep:novel chromosome:C_jacchus3.2.1:6:59073973:59117078:1 gene:ENSCJAG00000014982 transcript:ENSCJAT00000052324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWKCEHHSLYGAAQYRLALKNGHGTAIWNASDVWKKGGSEESLCDQPYHEIYTKDGNS
YGRPCEFPFLIDGTWHHECILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNE
RFGSCYQFNTQAALSWKEAYVSCQNQGADLLSINSAAELTYLKEKEGIARIFWIGLNQLY
SARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPL
NNTVELTDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHTKCKAFGSDLISIHSLAD
VEVVVIKLHNEDAKEEIWTGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVS
YLGELGQWKVQSCEEKLKYVCKKKGEKRNDTSSDKMCPPDEGWKRHGETCYKIYEDEAPF
GTNCNLTITSRFEQEYLNDLMKKYDKSRRKYFWTGLRDVDSHGEYNWATVGGRKQAVTFS
NWNFLEPASPGGCVAMSTGKSLGKWEVKDCRSFRALSICRKISGPLEPEEAAPKPDEPCP
EGWQSLPSSLSCYKVFHAERIVRKRNWEEAERFCQALGAHLSSFSHADELKDFLHFLMDQ
FR
Download sequence
Identical sequences F6WMZ6
ENSCJAP00000051399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]