SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051432 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051432
Domain Number 1 Region: 140-373
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 503-658,698-776
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 824-1087
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.51e-29
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051432
Domain Number - Region: 1092-1239
Classification Level Classification E-value
Superfamily EF-hand 0.00789
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051432   Gene: ENSCJAG00000007392   Transcript: ENSCJAT00000061455
Sequence length 1782
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:29511044:29622646:1 gene:ENSCJAG00000007392 transcript:ENSCJAT00000061455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSTEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRN
TSMPTSETESVNTENVSGEAETRGCCRSLWCWWRRRGATKAGPSGCRRWGQAISKSKLSR
RWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLL
ALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRL
LRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQT
KRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQVANSDNKV
TIDDYREEDEDKDPYPPCDVPGDGEEQEGFASYEPEVPAGPRPRRISELNMKEKIAPIPE
GSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYF
DYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKI
LRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFY
RCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEG
WPALLYKAIDSNGENVGPVYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKE
YKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCL
AMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKHYFTDAWNTFDALIVVGSVV
DIAITEVNPTESETVPVPTATPGNSVCSACNSSFHIMLFKVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMKDNNQINRNNNFQTFPQAVLLLFRK
RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKI
WKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIAL
QAGLRTLHDIGPEIRRAISCDLQDDEPEEAKREEEDDVFKRNGALLGNHVNHVNSDRRDS
LQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNN
ANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQL
PTICREDPEVHGYFRDPRCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNMDFER
PRGYHQPQGFLEDDDSPICYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEIPSS
PTFFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTP
LIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTIPSSFRNKNSDKQRSAD
SLVEAVLISEGLGRYARDPKFVSATKYEIADACDLTIDEMESAASTLLNGNVRPRANGDV
GPLSHQQDYELQDFGPGYSDEEPDLGRDEEDLADEMICITTL
Download sequence
Identical sequences F7BKP4
ENSCJAP00000051432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]