SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051531 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051531
Domain Number 1 Region: 50-166
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.06e-29
Family Acyl-CoA thioesterase 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051531   Gene: ENSCJAG00000017332   Transcript: ENSCJAT00000055081
Sequence length 171
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:39896449:39912536:-1 gene:ENSCJAG00000017332 transcript:ENSCJAT00000055081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPQTPEDGQGHGGRGDPRGDLRSVLVTSVLNLEPLDEDLFRDPNLQKSYPVLLNKIAA
QEMPIEIKPVNPPTLSQLQRMEPKQMFWVRAQGYIGEGDMKMHCCVAAYISDYAFLGTAM
LPHQCQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGVGIFIFKMRG
Download sequence
Identical sequences F6W313
ENSCJAP00000051531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]