SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051822 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051822
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 7.56e-72
Family Integrin A (or I) domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 1128-1312
Classification Level Classification E-value
Superfamily Fibronectin type III 7.87e-37
Family Fibronectin type III 0.00000347
Further Details:      
 
Domain Number 3 Region: 1522-1723
Classification Level Classification E-value
Superfamily Fibronectin type III 7.79e-35
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 991-1109
Classification Level Classification E-value
Superfamily CalX-like 2.75e-20
Family CalX-beta domain 0.00094
Further Details:      
 
Domain Number 5 Region: 625-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.75e-18
Family Integrin beta tail domain 0.0026
Further Details:      
 
Domain Number 6 Region: 27-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000837
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051822
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 468-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051822   Gene: ENSCJAG00000014116   Transcript: ENSCJAT00000062550
Sequence length 1818
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:124961019:125000981:1 gene:ENSCJAG00000014116 transcript:ENSCJAT00000062550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPHPSPWARLLLAALISASLSGALANRCKKAPVKSCTECIRVDKDCAYCTDEMFRDRR
CNTRAELLASGCQRESIMVMESSFQITEETQIDTTLHRSQISPQGLRVRLRPGEEQHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLAQVLSRLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMNRNDERCHLDATGSYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTKTGSFHIRRGEVGMYQVQLRAIEHVDG
THVCQLPEEDQKGNIHLKPSFSDGLKMDVGIICDVCPCELQKEVRSARCSFNGDFMCGHC
VCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGHGECQCGHCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPDWTGPSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCNQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGHTCEECSFKVKMVD
ELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHRKKDCPPGSFWWLIPLLL
LLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRQNLMASDHLDTPML
RSGNLKGRDVVRWKVTNNVQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTRE
CTQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALL
KLTEKQVEQRAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDIPAGTATLGRRLVNITIIKEQASGVVSFEQPEYLVSRGEQVARIPVIRRVLDS
GKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQARRF
HVQLSNPKFGAHLGQHHSTTIIIRDPDEVDRSFTSQMSSQPPPHGNLGAPQNPNAKAAGS
RKIHFNWLPPSGKPTGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSPVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSISDDTGCGWKFEPLLG
EELDLRRITWRLPPELIPRLSASSGRSSDAEAPTGPRMTARAGRAAACPATPGPLGEHLM
NGRMDFAFPGSANSLHRMTTSSAAYGTHLSPHLPHRVLSTSSTLTRDYHSLTRSEHSHSA
TLPRDYSTLTSVSSHDARPTAGVPDTPTRLVFSALGPTSLRVSWQEPRCEHALQGYSVEY
QLLNGGEVHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHP
QSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGG
GTATTFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQ
LGSHVGLFQHPLQGEYSSITTTHTSAMEPFLMDGLTLGAQHLEAGGSLTHHVTQEFVSRT
LTTSGTLSSQVDQQFFQT
Download sequence
Identical sequences F6XT28
ENSCJAP00000051822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]