SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052179 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052179
Domain Number 1 Region: 27-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.93e-22
Family Ribosomal L11/L12e N-terminal domain 0.000025
Further Details:      
 
Domain Number 2 Region: 103-168
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000497
Family Ribosomal protein L11, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052179   Gene: ENSCJAG00000015256   Transcript: ENSCJAT00000029701
Sequence length 185
Comment pep:novel chromosome:C_jacchus3.2.1:2:14014866:14015754:-1 gene:ENSCJAG00000015256 transcript:ENSCJAT00000029701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSAQRRPRCNFLWLSQISVHLTPAASTVLPKFDPSEIKVIYLRCSRGEVGVTSVLAPKI
RPLVLSSKKAGDDIAKTTGDWKGLRITVKLTIQNRQAQIALVPASALIIKNLKELPRDRK
KQKIITFDETVSISQMWHRSLARELCGTIKEILRTAQSVGCNADGCHPHDIIDDINSGVV
NAQLV
Download sequence
Identical sequences F7HXZ8
ENSCJAP00000052179 ENSCJAP00000052179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]