SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052238 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052238
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.09e-32
Family Methylmalonyl-CoA epimerase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052238   Gene: ENSCJAG00000011751   Transcript: ENSCJAT00000022816
Sequence length 176
Comment pep:novel chromosome:C_jacchus3.2.1:2:180641107:180642308:1 gene:ENSCJAG00000011751 transcript:ENSCJAT00000022816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHKLKVAAANSVRLFSKLHAPVRTVRAFSTSQPLDQMAGCVWKLGRLNHVAIAVLDLEK
AAAFYKNILGAHVSEAVPLPEHGISVVFVNLKNTKMELLHPLGSESPIAGFLQKNKAGGM
HHVCIKVDNIKAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences F7ILE6
ENSCJAP00000052238 ENSCJAP00000052238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]