SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052412 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052412
Domain Number 1 Region: 60-156
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.00000000441
Family Ribosome-binding factor A, RbfA 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052412   Gene: ENSCJAG00000020394   Transcript: ENSCJAT00000040040
Sequence length 254
Comment pep:novel chromosome:C_jacchus3.2.1:10:1191383:1192315:-1 gene:ENSCJAG00000020394 transcript:ENSCJAT00000040040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVSYGNKNLLKKFAKIMFWYEVPSLGSHFTNQPSKLELLMKNTLKSIKEAHICLCLRTRD
GLLYKALTDCCTSDVKQDIYNLTMQLSKASLTSDLSAYNTTLFAEQNEHTEAILRKSTVQ
MKHLWMSQQTLRNVLPIQFVQDKQNVALAEIDQLLAMVECGPSDEKDFMQNDFRERHCQP
MPWNLLCAQGLCGINHGALNKQSMGYNRKRKDGNMSPAWPKQEQEQLAEMTAPMKKRKRK
AKPLVVDDNCPKNY
Download sequence
Identical sequences F7I9L8
ENSCJAP00000052412 ENSCJAP00000052412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]