SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052427 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052427
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.44e-22
Family Nucleoplasmin-like core domain 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052427   Gene: ENSCJAG00000019026   Transcript: ENSCJAT00000037330
Sequence length 224
Comment pep:novel chromosome:C_jacchus3.2.1:11:117996114:117998362:-1 gene:ENSCJAG00000019026 transcript:ENSCJAT00000037330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTMDMDMSPRPQNYLFGGELKADKDDDFKVDNDENEQQFSVRTVSVGAGAQDELQVVE
AEAINYKGSPIKGTLATLKMSVPTMVSLGALKCGPMVEVWFRASDISGQHLVAVEEDAES
EDEEEEDVKLLSISGERSAPGGGSRFPQKKVKLAAGKLKKSASETPAINGQKSNQNGKDS
KPSSTPRSKGQKFKKREKTPKTPIGPSSVAELLASFSSSLPPSH
Download sequence
Identical sequences F7I787
ENSCJAP00000052427 ENSCJAP00000052427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]