SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000141 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000141
Domain Number 1 Region: 4-324
Classification Level Classification E-value
Superfamily ALDH-like 1.17e-63
Family ALDH-like 0.0000219
Further Details:      
 
Domain Number 2 Region: 339-591
Classification Level Classification E-value
Superfamily ALDH-like 1.19e-39
Family ALDH-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000141   Gene: ENSCJAG00000000074   Transcript: ENSCJAT00000000149
Sequence length 595
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:41329321:41375741:1 gene:ENSCJAG00000000074 transcript:ENSCJAT00000000149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTGVIGLILPPTFSFLELMWRICPALAVGCTVVALVPPASPTPLLLAQLAGELGSFPGI
LNVISGPASLGPILATQPAIQKVAFCGALEEGRVLRRSLAGECVELGLALGMESLLLLTD
TADMDSAAEGVVDAAWSDRGPGGLRLLIQESVWDEFMRRLQERMGRLRSGRGLDGAVDMG
TRGAAACDLAQRFVHEAQSQGAQVFQAGDVPPKRPFYPPTLVSNLPPASPCAQAEVPWPV
VVASPFRTAKEALAVANGTPRGGSASVWSERLGQALELGYGLQMGTVWINAHGLRDPSVP
TGGCKESGCSWHGGPDGLYEYLRPSRTPTQVCCLSKNMSYDTFGLAVPSTLPAGPEIGPS
PAPPYGLFIGGRFQAPGARSSRPIWDSSGNLHGYVAEGGAKDIRGAVEAAHQASPGWAGQ
SPGARAGLLWALAAALERRKSTLASRLERQGVELKTAEVEVELSARRLRAWGARAQAQGH
TLQVSGLRGPVLRLREPLGVLAVVCPDEWPLLAFVSLLAPALACGNTVVMVPSAACPLLA
LEVCQDMATLFTAGLANVVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWAS
Download sequence
Identical sequences F7EJA7
ENSCJAP00000000141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]