SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002117 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002117
Domain Number 1 Region: 45-69,150-354
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.65e-23
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002117   Gene: ENSCJAG00000001207   Transcript: ENSCJAT00000002235
Sequence length 417
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:81316430:81319907:1 gene:ENSCJAG00000001207 transcript:ENSCJAT00000002235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRAPELYRAPFPLYALQVDPSAGLLIAAGGGGAAKTGIKNGVHFLQLERINGRLSAS
LVHSHDTETRATMNLALAGDILAAGQDAHCQLLHFQAHQQKGNKAEKAGSKEQGPRQRKG
AVPAEKKCGVETQQEGLELRVENLQVVQTDFSPDPLQKVVCFNHDNTLLATGGTDGYVRV
WKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGWDLKASVWQKDQLVTQLHWQENGPTF
SSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH
EVISCLNVSESGTFLGLGTVTGSVAIYIAFSLQCLYYMRESHGIVVTDVAFLPEKGRGPE
LLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLACVGLIVVTILLLQSAFPGFL
Download sequence
Identical sequences F7IJ09
XP_002757990.1.60252 ENSCJAP00000002117 ENSCJAP00000002134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]