SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002499 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002499
Domain Number 1 Region: 28-121
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000953
Family N-acetyl transferase, NAT 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002499   Gene: ENSCJAG00000001411   Transcript: ENSCJAT00000002640
Sequence length 203
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:109540742:109784887:-1 gene:ENSCJAG00000001411 transcript:ENSCJAT00000002640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFCDGNKEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSF
LSLGVYSALRREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYKGQYRPSDLLCPETYVW
VPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRVQVFHKRAIMPYGVYKKHQKDPSEE
AAVLQYASLVGQKCSERMLLFRN
Download sequence
Identical sequences F7HQB7
ENSCJAP00000002499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]