SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008358 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008358
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-154
Family ALDH-like 0.00000000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008358   Gene: ENSCJAG00000004575   Transcript: ENSCJAT00000008838
Sequence length 424
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:40236146:40261676:1 gene:ENSCJAG00000004575 transcript:ENSCJAT00000008838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCRILLEAARIIRERKDEIATVECINNGKSIFEARLDIDTSWQCLEYFAGLAASMAGE
HIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSAL
LLAEIYTEAGVPPGLFNVVQGGVATGQFLCQHHDVAKVSFTGSVPTGMKIMEMASKGVKP
VTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVK
QTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDTYVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILPFDTEAEVLERANDTTFGLAAGVFTRDIQR
AHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDV
ESAF
Download sequence
Identical sequences F7HTM7
ENSCJAP00000008358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]