SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009988 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009988
Domain Number 1 Region: 155-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.15e-21
Family Middle domain of MutM-like DNA repair proteins 0.016
Further Details:      
 
Domain Number 2 Region: 62-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000706
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 318-345
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000089
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009988
Domain Number - Region: 245-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00123
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009988   Gene: ENSCJAG00000005464   Transcript: ENSCJAT00000010553
Sequence length 606
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:12180372:12239090:-1 gene:ENSCJAG00000005464 transcript:ENSCJAT00000010553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRNLQGRALFLAAPSAVVSPQAAVLNNKD
SSQNALSLFNGYVYDGVETLGKELFMYFGPKALRIHFGMKGCVMINPLEYKYKNGASPVL
EMQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPTFSFLRAESEVKKQKGRMLGD
VLMDQSVFPGVGNIIKNEALFDSALHPAVKVCQLTDGQIHHLVKMIRDFSILFYRCRKAG
LAVSKHFKVYKRSNCGQCHGRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNSVI
SWTPSRVDHVMESVARKSEEQWTCVVCTLINEPSSKACDACLTSRPIDSVVKNEENSTAF
SNLVKYPCNTFGKPHTEVKINRKTTFGTTTLVLTDFSNKSSTLERKAKQNQILDEEFQIS
PPTNVCLSDTQHPSKKRTNDITQLSSKANVSPTVSSESKLFSPTHKKLKTAHYSSPDLKS
CNPGYSNSELQINMTDGPRTLNPDTPRCSKHNCLCILRVVRKDGENKGRHFYACPLPREA
QCGFFEWADLSFPFCNHGKRSIMKTVLKIGPNNGKNFFGCPLGKEKQCNFFQWAENGPGI
KIIPGC
Download sequence
Identical sequences F7HC39
XP_002745242.1.60252 ENSCJAP00000009988 ENSCJAP00000009988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]