SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012917 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012917
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000354
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012917   Gene: ENSCJAG00000006975   Transcript: ENSCJAT00000013614
Sequence length 219
Comment pep:novel chromosome:C_jacchus3.2.1:2:36156478:36157154:-1 gene:ENSCJAG00000006975 transcript:ENSCJAT00000013614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNICSVRLEDLMNMQHCNLLCLPEKYQVKYYSNHGLSWPQLSYIAEGENGKIVGYVLAKM
EKDPYDVPHGHITSGLAQKLMDQASQAMIENFNAKYVSLHVRSNQAALHLYSNTLNFQIS
EVEPKYYAHGEDAFAMKRDLTQMADELRQHLELKEKGRHVVLGAIENKVESKGSSPPSHE
EKGLAAKDNGGDSKDLSEVSKTIESTDVKDSSEASDSAS
Download sequence
Identical sequences F6S1N8
ENSCJAP00000012917 ENSCJAP00000012917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]