SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014444 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014444
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.94e-81
Family Calponin-homology domain, CH-domain 0.000000636
Further Details:      
 
Domain Number 2 Region: 329-439
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 409-548
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 515-653
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-17
Family Spectrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014444   Gene: ENSCJAG00000033599   Transcript: ENSCJAT00000015221
Sequence length 770
Comment pep:novel chromosome:C_jacchus3.2.1:X:31281328:31867402:-1 gene:ENSCJAG00000033599 transcript:ENSCJAT00000015221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDEREDVQKKTFTKWINAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGS
TRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIM
AGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVS
QQSATQRLEHAFNIARYQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAI
QEVEMLPRPPKVTKEEHYQLHHQMHYSQQITVSLAQGYERTTSSPKPRFKSYAFTQAAYV
ATSDPTRSPFPAQHLEAPEDKSFGSSLMESEVNLDHYQTALEEVLSWLLSAEDTLQAQGE
ISNDVEVVKEQFHTHEGYMMDLTAHQGRVGNILRLGSQLIGTGKLSEDEETEVQEQMNLL
NSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLEDLK
RQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEETIKVLGDRWANICRWT
EDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLK
ADLEKKKQSMDKLYSLKQDLLSTLKNKSVTKKTEAWLENFARCWDNLVQKLEKSTAQISQ
AVTTAQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRLDVD
ITELHSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNVGYAFICVLILRL
Download sequence
Identical sequences F7HXL8
ENSCJAP00000014444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]