SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015030 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015030
Domain Number 1 Region: 1510-1743
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000569
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number 2 Region: 1246-1439
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000015030
Domain Number - Region: 533-650
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00654
Family Myosin rod fragments 0.0068
Further Details:      
 
Domain Number - Region: 864-945
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015030   Gene: ENSCJAG00000008057   Transcript: ENSCJAT00000015859
Sequence length 2013
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:50786501:50842344:1 gene:ENSCJAG00000008057 transcript:ENSCJAT00000015859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGLARAQEAELTLETVIQTLESSVLCQEKGSGARDLAQDAQTTSLPARIREIVTRNLS
RPESPVLLPATEMASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVSERLEQ
AVRLESGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQAKI
LQYKKRCSELEQQLLERSGELEQQRLRETEHSQDLERALIRLEEEQHRSASLAQVNAMLR
EQLDQAGSANQALSEDIRKVTSDWTRSCKELEQREAAWRREQESFNAYFSNEHSRLLLLW
RQVLGFRRLVSEVKMSTERDLLQLGGELARTSRAVQEAGLGLSTGLQLAESRAEAALEKQ
TLLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELALAVERLQKQNLEKDQVN
KDLTEKLEALESLRLQEQAALETEDGEGLQQTLRDLAQAVLSDAESGVQLSSSERTADAS
DGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPAFSDSSTLALIHSALHKRQLQVQDMRG
RYEASQDLLGTLRKQLSDTEGERRALEEQLQRLRDKTDGATQAHEDAQREVQRLRSANEL
LSREKSNLAHSLQVAQQQAEELRQEREKLQATQEELRRQRDRLEEEQEDMVQDGARVRRE
LERSHRQLEQLEGKRSVLAKELVEVREALSRATLQQDMLQAEKAEVAEALTKAEAGRVEL
ELSMTKLRAEEASLQDSLSKMSALNESLAQDKLDLNRLVAQLEEEKAALQGWQRRAEQEA
TVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSRLQEQLAQLS
RQLSGREQELEQARREAQRQVEALERVAREKEALAKERSGLAVQLAAAEREGRTLSEEAT
RLRLEKEALESSLFEVQRQLAQLEARREQLEADGQALLLTKETLTGELAGLRQQIIATQE
KASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQL
QREQEELLARMEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMG
TRHNLATISLEMERQKRDAQSRQEQDRSTVNALMSELRDLRAQMEETAAAHAQEVRRLQE
QGRDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGE
LRRSLGEGTKEREALRRSNEELRAAVKKAESERISLKLANEDKEQKLALLEEARTAVGKE
AGELRTGLQEVERSRLEARRELQELRRQMKVLDSENTRLGRELAELQGRLVLGERAEKES
RRETLGLRQRLLKGEARLEVMRQELQVAQRKLQEQEGEFRTRERGLLGSLEEARATEKQQ
LDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEAQRRAAEAQLGGLRSAL
RRGLGLGRAPSPAPQPVPSSPAREAPARGSREGLSSPSALECSPGSQPPSPGPATSPAPP
DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKVV
AESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQ
EKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQ
ALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSA
SLNSTQDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVAD
LELQRVEAEGQLQQLREVLRQRQEGEAAALHMVQKLQDERRLLQERLGSLQHALAQLEAE
KREVERSALRLEKDRVALKRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEA
QRQIQQLEAQVVALEQSHSPAQLEVDEQQQQRELQQEVERLRSAQAQTERTLEARERAHR
QRVRGLEEQVSTLQQELRRSSAPFSPPSGSPEK
Download sequence
Identical sequences F7G7B4
ENSCJAP00000015030 XP_002750377.1.60252 ENSCJAP00000015030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]