SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015450 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015450
Domain Number 1 Region: 40-293
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.78e-41
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015450   Gene: ENSCJAG00000008395   Transcript: ENSCJAT00000016323
Sequence length 299
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:114616503:114625991:1 gene:ENSCJAG00000008395 transcript:ENSCJAT00000016323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMILLNNSQKLLALYKSLARSIPESLKVYGSVYHINHGNPFNLEVLVDSWPEYRMVIIRP
QKQEMTDDMDLYTNVYRIFSKEPQKSQEILKNCEIINWKQILQIQGFQGSLGEGIRVAAF
SKSVKVEHSRAILFITEDILNLNASNKSKFGSWAETGHPDVEFESETPDFKYAQLDVSYS
GLVNDRWRRGKNERSLRYIKRCIEALPTACVLGPEGIPVSWVTMDPSCELGMAYSMERYR
KKGKMRQTMVQFKKYLRQNNIPFYLSVLEFNEDSRRSVKQNGFFEAACEWHQWTCYPQI
Download sequence
Identical sequences F7GPF9
ENSCJAP00000015450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]