SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015462 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015462
Domain Number 1 Region: 43-297
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.21e-45
Family Hypothetical protein cg14615-pa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015462   Gene: ENSCJAG00000008404   Transcript: ENSCJAT00000016336
Sequence length 302
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:114566450:114572266:-1 gene:ENSCJAG00000008404 transcript:ENSCJAT00000016336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGRFILPAPVTSPSSSFWTPIIVFLFMGLFVYGAIYNIKNKNPFKMEVLVDAWPDYQTVI
TRPQKQEMKDDQDHYTNTYHIFTKAPDKLEEVLSCSQVINWEQTFQIQGCQEGLDEAIRK
VATSKSVQVDYVKTMLFIPESLKKHKSSSNDKTELSERHKVDDSNKKGKRNFSNMFLDAS
HAGLINEHWAFGKNERSLKYIERCLQDFLGYGVLGPEGELVSWIVMEQSCELRMGYTIRK
YRRQGNMSQISYHLEKYLSQKDIPFYIHAADTNEKILQTLKDIGYNICPCGWHQWKCTPK
KY
Download sequence
Identical sequences F7GHB0
ENSCJAP00000015462 ENSCJAP00000045405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]