SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018246 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018246
Domain Number 1 Region: 125-351
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.28e-44
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018246   Gene: ENSCJAG00000009916   Transcript: ENSCJAT00000019279
Sequence length 951
Comment pep:novel chromosome:C_jacchus3.2.1:4:70905108:71549348:1 gene:ENSCJAG00000009916 transcript:ENSCJAT00000019279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKSLDSFQAAHKFCS
NKQKLFRMYTSRKQSQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKV
QKSWSFNDRTRFRPSLRLKSSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTV
IRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQIT
SDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALAL
ASFQIPPFECEQTSDYQSPVDSKDLSGSGQNSGCLSRSTSANISRGLQFILTPNEFSAQT
FYALSPTMHSQATQVPMSQSDGSAVAATNTIANQINPAPKPAAPTTLQIPPPLPAIKHLP
RPETLHPNPAGLQESISDITTCLVASKENVQVAQSNLTKDRSVRKSFDMGGETLLSVCPM
VPKDLGKSLSVQNLIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEET
ETDTFDAAQQPAREAAFASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Download sequence
Identical sequences F7GQY9
ENSCJAP00000018246 ENSCJAP00000018242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]