SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024129 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024129
Domain Number 1 Region: 464-541
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.33e-16
Family P4 origin-binding domain-like 0.0085
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily ARID-like 0.00000000000116
Family ARID domain 0.0031
Further Details:      
 
Domain Number 3 Region: 102-146,202-402
Classification Level Classification E-value
Superfamily ARM repeat 0.00000267
Family Clathrin adaptor core protein 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000024129
Domain Number - Region: 1572-1597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0706
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024129   Gene: ENSCJAG00000013099   Transcript: ENSCJAT00000025523
Sequence length 1775
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:25203143:25402724:-1 gene:ENSCJAG00000013099 transcript:ENSCJAT00000025523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQ
LPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCT
LLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIV
DDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEEG
NVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTK
CLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLEV
LYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPEALAAVKLVEHPSSSHQILSEI
RPQAIEQVQTQTHVASTPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVS
RAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSNNGQAHIHVVGVKR
RAIPLPIQMYYQQQPVTTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHFQRTPVPNQSSN
LTATQMSFPVQGVHTVAQTVSRIPPNPSVHTHQQQNASVTVIQNKAPIPCEVVKATVIQN
SIPQTTVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVPG
QIPSGTPVTVIQQAVPQSHIFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSTGSQ
SQDTVIIAPPQYVTTPASNIVSATSVQNFQVTTGQMVTIAGVPSPQPSRVGFQNIAPKPL
PSQQISSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPTGQTVQ
LTGQPSITPSSSPSPVPATNNQVPTAMSSSSTSQSQGPPPTVSQMLSVKRQQQQQHSPAP
PPQQVQVQVQQPQQVQMQVQPQQSNAGVGQPASGESSLIKQLLLPKRGPSTPGGKLILPA
PQIPPPNNARAPSPQVVYQVASNQATGFGVQGQTPAQQLLVGQQNVQLVQSAMPSTGGVQ
TVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFATATVSQGNATQLIAPAGI
TMSGTQPGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHER
KIEVMENPSCRRGTTNTSNGDTKENEMQLGSLLNGRKYSDSSLPPSNSGKIQSETNQCSL
ISNGPSVELGENGASGKQNSEQIDMQDIKSDLKKPLVNGICDFDKGDGSHLSKNIPNHKT
SNHVGNGEISPVEPQGTLDVTQQDTAKGDQLERIPNGPVLTLGGSSSVSSIQEASNMATQ
QFSGTDFPNGPLASCLNSDVPQQRPSVVVSPHSTTSVIQGHQILAVPDSGSKVSPSPALS
SDVRSTNGTAECKTVKRPAEDNDRETVTGIPNKVGVRIVTISDPNNAGCSATMVAVPAGA
DPSTVAKVAIESAVQQKQQHPPTYVQNMVPQNTPMPPSPAVQVQGQPNSSQPSPFSASSQ
HGDPVRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF
SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKASTKQPAVGGTSSTPRAQKAIVNHPSAA
LMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVL
AISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ
Download sequence
Identical sequences F7E6F5
ENSCJAP00000024129 ENSCJAP00000024129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]