SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024941 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024941
Domain Number 1 Region: 160-256
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-18
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 7-33,87-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.28e-16
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024941   Gene: ENSCJAG00000013561   Transcript: ENSCJAT00000026368
Sequence length 313
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:31605968:31615490:1 gene:ENSCJAG00000013561 transcript:ENSCJAT00000026368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGLLAGALAAYTAYMVRGALLVARREGPQEARLRAELGTLRAQLLQRSPCVAAPALD
AFVERVLAAGRLGRVVLANASGPANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGK
AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMHWGWDPWRAARWHLVALLGVV
VTICFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV
YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPTPCPTNFSEDEDDQVDILGPQPESHQQL
SASSHTDYASIPR
Download sequence
Identical sequences F6RD93
ENSCJAP00000024941 ENSCJAP00000024941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]