SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025844 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025844
Domain Number 1 Region: 684-808
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-29
Family Regulator of G-protein signaling, RGS 0.00041
Further Details:      
 
Domain Number 2 Region: 1026-1106
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-22
Family Ras-binding domain, RBD 0.0015
Further Details:      
 
Domain Number 3 Region: 228-361
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-21
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Domain Number 4 Region: 12-102
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 954-1007
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000062
Family Ras-binding domain, RBD 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025844   Gene: ENSCJAG00000014023   Transcript: ENSCJAT00000027310
Sequence length 1438
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:187358617:187530842:-1 gene:ENSCJAG00000014023 transcript:ENSCJAT00000027310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRAGEAAKRPLPGPAPLRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGHLESCSSDEEGGLYDGKGWL
KPKLDSKALGINRAERVVEDMQSGGIFNMIFENPGLCASSSEPLRLKQRSLSESAAVRFD
VGHESVNNPNPSMLSKEEVSKVIHDDLVFSVGLEGHDDFALDASILNVAMIVGYLGSIEL
PATSSSLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLGTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFHHKIHHGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAQQNNSTSS
NSDSGIGNFNQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGIPWTGPFCPDP
EGSPPFEAAHQTDRFRDLSKHLGPASPVELPPTSSRSSVPPSKRGTVGASSAFNQRWLPV
HVLREWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSAPKREWSRKAF
GMQNIFGPHRNVRKTKEDKKGSKFGRGIGLTQPSPRMPARRSFGRSKRFSITRSLDDLES
ATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPLGVR
YFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDVLRAPHPDMFKEQQLQAGQCLESVTDKRRVAFSRQCAVRSQSLLVLIIFNTRKS
SPESGHAAGLCKCHSASPPSHLNGKSKSGRSLNEELGDEDSEKKRKGAFFLWSRTRSTGR
SQKKREPGDHADDPLHANGGLCRRESEGSVSSSGSLDLSEACRTLAPEKDKATKHCCIHL
PDGTSCVVAVKAGFSIKEILSGLCERHGINGAAADLFLVGGDKVLTRLTFMLPLAGLLLC
TAAPTRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGGLLVRLSGEKEPLDLGAP
ISSLDGQRVVLEEKDPSRVKASTDKQKGAPVKQNTAVSSSSRNHSATGEERTLGKSNSIK
IKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEVEFFELISKAQSNRADDQRGLL
RKEDLVLPEFLRLPPGSTELTLPTAAAMAKGFSKRGATGSGRESASQPSEQWEPAQESSD
SPSTSPGSAPSPPGPPGTTSPGQKSPSGAFCTPQSPSSLEQEGTTQIWKRQSREVEAGGI
QTVEDEHVAELTLMGEGDISSPNSTLLPPPSAPQDALEPSRPGSRAHSGRGLPVNRIIDV
DLVTGSAPGRGGCTMGAWAGPGRSQVSGGSPTSDLPSLSPVPGEPAKHKASMHHATFV
Download sequence
Identical sequences F7AVD8
ENSCJAP00000025844 ENSCJAP00000025844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]