SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026568 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026568
Domain Number 1 Region: 131-224
Classification Level Classification E-value
Superfamily TAFH domain-like 3.79e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 417-464
Classification Level Classification E-value
Superfamily Histone-fold 3.64e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026568   Gene: ENSCJAG00000014438   Transcript: ENSCJAT00000028082
Sequence length 632
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:55999746:56030502:-1 gene:ENSCJAG00000014438 transcript:ENSCJAT00000028082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMVLVRSENGQLLIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPII
ARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQR
TVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEA
EDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPASQATTALTA
VVLSGSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRP
PQVTLTQTPMVALRQPHNRIMLTTPQPVQLSPLQPVPVVKPAVLPGAKALSAVSAQAAAA
QKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLS
APLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYE
QASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKANSRSRQEDPEQLRLKQKAKEMQQ
QELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGSGSVVPGSSGVGTPRQFTRQ
RITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences F7IBK6
ENSCJAP00000026568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]