SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028989 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028989
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-56
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 2-262
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 3 Region: 313-543
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-51
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 916-1177
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-38
Family YWTD domain 0.0000691
Further Details:      
 
Domain Number 5 Region: 1306-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000398
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 7 Region: 1268-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 1228-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 872-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 268-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1185-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028989   Gene: ENSCJAG00000015736   Transcript: ENSCJAT00000030633
Sequence length 1586
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:123840243:123983745:1 gene:ENSCJAG00000015736 transcript:ENSCJAT00000030633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGRVKLETTVVVSGLEDAAAVDFQFSKGVVYWTDVSEEAIKQTY
LNHTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLD
QPRAIALNPAHGYMYWTDWGEMPRIERAGMDGTTRNIIVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKR
KEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPVEPFYKCACPTGVQLQD
NGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTD
DEVRAIRRAYLDGSGAQTLINTDINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRK
ILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALD
LQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
HKVKASRDIIIDQLPDLMGLKAVNVAKIMGTNPCADENGGCSHLCFFTPRSTRCGCPIGL
ELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVANNHIYW
TDVSLKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQF
RQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTI
DYTDRRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERA
DKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHDNGQCGQLCLAIPGGHRCGCASH
YTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFI
YWVDGRQNIKRAKDDGTQAGPFVLTSLSQAQNPDRQPHDLSIDIYSRTLFWTCEATNTIN
VHRLSGEAIGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTT
GLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYW
IDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICI
AKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQ
SDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCV
LIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHSSAIGPVIGIILSLFVMGGIYFVCQR
VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGG
VPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATTRPYR
PYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDS
CPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences F7B2U9
ENSCJAP00000028989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]