SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029569 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029569
Domain Number 1 Region: 360-574
Classification Level Classification E-value
Superfamily Kelch motif 9.15e-62
Family Kelch motif 0.00000521
Further Details:      
 
Domain Number 2 Region: 22-136
Classification Level Classification E-value
Superfamily POZ domain 3.81e-34
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 3 Region: 269-347
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000183
Family Galactose oxidase, central domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029569   Gene: ENSCJAG00000016063   Transcript: ENSCJAT00000031244
Sequence length 577
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:69479601:69496278:-1 gene:ENSCJAG00000016063 transcript:ENSCJAT00000031244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKANEQMDHTSPTYMLANLTHLHSEQLLQGLNILRQHHELCDIVLRVGDVKIHAHKVVLA
SVSPYFKAMFTGNLSEKENSEVEFQCIDETALQAIVEYAYTGTVFISQDTVESLLPAANL
LQIKLVLKECCAFLESQLDPGNCIGISRFAETYGCHDLYLAATKYICQNFEAVCQTEEFF
ELTHADLDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSVKFL
TRLYEANHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRCAPKVLCAVGGKSGL
FACLDSVEMYFPQNDSWIGLAPLNIPRYEFGICVLDQKVYVIGGIETNVRPGVTIRKHEN
SVECWNPDTNTWTSLERMNESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQ
PVAPMTTTRSCFAAAVLDGMIYAIGGYGPAHMNSVERYDPSKDSWEMVASMADKRIHFGV
GVMLGFIFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGH
SGSSYLNTVQKYDPISDTWLDAAGMIYCRCNFGLTAL
Download sequence
Identical sequences F7I7N3
ENSCJAP00000029569 ENSCJAP00000029576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]