SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029576 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029576
Domain Number 1 Region: 354-568
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-62
Family Kelch motif 0.00000521
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily POZ domain 3.59e-34
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 3 Region: 263-341
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000183
Family Galactose oxidase, central domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029576   Gene: ENSCJAG00000016063   Transcript: ENSCJAT00000031251
Sequence length 571
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:69479601:69514892:-1 gene:ENSCJAG00000016063 transcript:ENSCJAT00000031251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHTSPTYMLANLTHLHSEQLLQGLNILRQHHELCDIVLRVGDVKIHAHKVVLASVSPYF
KAMFTGNLSEKENSEVEFQCIDETALQAIVEYAYTGTVFISQDTVESLLPAANLLQIKLV
LKECCAFLESQLDPGNCIGISRFAETYGCHDLYLAATKYICQNFEAVCQTEEFFELTHAD
LDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSVKFLTRLYEA
NHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRCAPKVLCAVGGKSGLFACLDS
VEMYFPQNDSWIGLAPLNIPRYEFGICVLDQKVYVIGGIETNVRPGVTIRKHENSVECWN
PDTNTWTSLERMNESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMT
TTRSCFAAAVLDGMIYAIGGYGPAHMNSVERYDPSKDSWEMVASMADKRIHFGVGVMLGF
IFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGHSGSSYL
NTVQKYDPISDTWLDAAGMIYCRCNFGLTAL
Download sequence
Identical sequences F7I7K3
XP_002753897.1.60252 XP_003930612.1.74449 XP_009004232.1.60252 XP_010339418.1.74449 XP_010339419.1.74449 XP_017365313.1.71028 XP_017365314.1.71028 XP_017365315.1.71028 XP_017832564.1.60252 ENSCJAP00000029576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]