SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033460 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033460
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.49e-83
Family Acetyl-CoA synthetase-like 0.0000265
Further Details:      
 
Domain Number 2 Region: 753-829
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000288
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 
Domain Number 3 Region: 553-606
Classification Level Classification E-value
Superfamily ACP-like 0.00000955
Family Peptidyl carrier domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033460   Gene: ENSCJAG00000018076   Transcript: ENSCJAT00000035351
Sequence length 856
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:137158922:137202025:1 gene:ENSCJAG00000018076 transcript:ENSCJAT00000035351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIDPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLNYDTFTVEHNDLVLFRLHWKNTEVDLMLSDGKEKYEKEKIRNSVSSEHVNEEKV
EERMDLRLEHCLAYVLHTSGTTGIPKIVRVPHECIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSIKLLPSKLATVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEVFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KILNSTLKCELPVHLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDGEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDALVKDYIFKELQKHLPSHAIPDELVLIDTLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPDLLKVPDESRFLNSGGDSLKSMRLLSEIEK
LVGTLVPGLLEMILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSNINQEEASGTSL
HQKAIMTLSCHNKINAFVALSRGSQILSLNTTRFLPKLGHCSSAYPSDSVSQTNTQNLKG
LNSPVLIGKSKDPSCVAKVPEEGKPAIGTQKMELHMRWRSDTGKCVDASPLVVIPSFDES
STTVYIGSHSHKMKAVDFYSGKVKWEQSLGDRIESSACVSKCGNFIVVGLAVLYQWTNLF
IPMYLTIRAKNIFWFP
Download sequence
Identical sequences F6QQZ8
ENSCJAP00000033460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]