SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036587 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036587
Domain Number 1 Region: 764-1057
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.62e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000201
Further Details:      
 
Domain Number 2 Region: 2-256
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.23e-76
Family Carbonic anhydrase 0.000013
Further Details:      
 
Domain Number 3 Region: 1061-1347
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.8e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 284-378
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000785
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036587   Gene: ENSCJAG00000019680   Transcript: ENSCJAT00000038645
Sequence length 1382
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:38120791:38436493:1 gene:ENSCJAG00000019680 transcript:ENSCJAT00000038645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAYGPEHWVTSSVSCRGRHQSPIDILDQHARVGEEYQELQLDGFDNESSNKTWMKNTGKT
VAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRYPVEMQIFFYNPDD
FDSFQTAISENRIIGAMAVFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRDLLP
ASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLR
NNFRPQQGLHDRVVSKSAVRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQTAL
QVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYLFRV
QAVCRDDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSS
GIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAAS
ASKQAARPVLAATEALASPGPDGDSSPTKDSEGTEEGEKDEKSESEDGEREHEEDGEKDS
EKKEKSGVTRAAEERNQMEPSPAPLSPNRTAEGGHQTIPGHEQDRIAVPTDQTGGRRDAG
PGLDPDAVTSTQVPPTATEEQYAGSDPKRPEMPSKKPVSRGDRFSEDSRFITVNPAEKNT
SGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREVPSS
GERGEKGSRKCFQTAHFYVEDSNSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGELYSN
NQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKH
SDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQ
YWPTENSEEYGNIIVTLKSTKVHACYTVRRFAVRNTKMKKGQKGNPKGRQNERIVIQYHY
TQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDK
STVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPG
VGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKGT
DYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYW
PSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPD
APISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVA
KMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMES
LV
Download sequence
Identical sequences F7F8S2
ENSCJAP00000036587 ENSCJAP00000036587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]