SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041966 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041966
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.43e-104
Family Phosphoglycerate kinase 0.000000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041966   Gene: ENSCJAG00000034433   Transcript: ENSCJAT00000052287
Sequence length 281
Comment pep:novel chromosome:C_jacchus3.2.1:4:141526138:141527515:1 gene:ENSCJAG00000034433 transcript:ENSCJAT00000052287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDMKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPCLAILGGAKVAYKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTS
LFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVAYGIPAGWMGLDY
GPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDT
ATCCARWNTEDKVSHVSTGGGARLELLEGKVLPGVDALSNI
Download sequence
Identical sequences F7GGE1
ENSCJAP00000041966 ENSCJAP00000048412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]