SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043617 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043617
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000265
Family N-acetyl transferase, NAT 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043617   Gene: ENSCJAG00000001411   Transcript: ENSCJAT00000058564
Sequence length 219
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:109698132:109855190:-1 gene:ENSCJAG00000001411 transcript:ENSCJAT00000058564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIHKNSPDTPTESQFTRFLCTSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDIL
PNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYK
GQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRVQVFHKRAI
MPYGVYKKHQKDPSEEAAVLQYASLVGQKCSERMLLFRN
Download sequence
Identical sequences F7IET6
ENSCJAP00000043617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]