SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044214 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044214
Domain Number 1 Region: 148-269
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-38
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 2 Region: 42-155
Classification Level Classification E-value
Superfamily FKBP-like 1.57e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 271-375
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-31
Family FKBP immunophilin/proline isomerase 0.00055
Further Details:      
 
Domain Number 4 Region: 383-456
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000204
Family Calmodulin-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044214   Gene: ENSCJAG00000012179   Transcript: ENSCJAT00000061955
Sequence length 470
Comment pep:known_by_projection scaffold:C_jacchus3.2.1:GL286451.1:329550:339877:-1 gene:ENSCJAG00000012179 transcript:ENSCJAT00000061955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSYSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSILLRPPHCPRMVQDGDFMRYH
YNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACIGERRRITIPPHLAYGEN
GTGDKIPGSAVLIFNVHVIDFHNPADVVEIKTLSRPSETCNETTKLGDFVRYHYNCSLLD
GTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGENGARGVPG
SAVLRFEVELVSREDGLPTGYLFVWHEDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSE
GKGRLMPGQDPEKTIGDMFQNQDRNQDGKITVEELKLKSDEDQERVHEEL
Download sequence
Identical sequences H9KY24
ENSCJAP00000044214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]