SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046667 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046667
Domain Number 1 Region: 34-66
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000588
Family N-acetyl transferase, NAT 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046667   Gene: ENSCJAG00000020261   Transcript: ENSCJAT00000062039
Sequence length 81
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:84451389:84479368:-1 gene:ENSCJAG00000020261 transcript:ENSCJAT00000062039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKRFGFEIIETKKNYYKRIEPADAH
VLQKNLRVPSAQNADVQKTDN
Download sequence
Identical sequences F7IK72
ENSCJAP00000046667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]