SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047135 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047135
Domain Number 1 Region: 124-355
Classification Level Classification E-value
Superfamily Kelch motif 1.24e-35
Family Kelch motif 0.017
Further Details:      
 
Domain Number 2 Region: 9-168
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.1e-23
Family Galactose oxidase, central domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000047135
Domain Number - Region: 355-393
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000836
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047135   Gene: ENSCJAG00000014569   Transcript: ENSCJAT00000055074
Sequence length 412
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:94071139:94106453:1 gene:ENSCJAG00000014569 transcript:ENSCJAT00000055074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPSS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPYKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQTASSDSSAAPNLQDQ
Download sequence
Identical sequences F7HUQ6
ENSCJAP00000047135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]