SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052269 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052269
Domain Number 1 Region: 67-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052269   Gene: ENSCJAG00000005775   Transcript: ENSCJAT00000065063
Sequence length 125
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:13954163:13954564:1 gene:ENSCJAG00000005775 transcript:ENSCJAT00000065063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQTRGPEPGEPGRKDLQH
LSREAAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLN
HVLDV
Download sequence
Identical sequences F7IGV7
ENSCJAP00000052269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]