SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337287629|ref|YP_004627101.1| from Thermodesulfobacterium sp. OPB45

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|337287629|ref|YP_004627101.1|
Domain Number - Region: 73-117
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.000484
Family Phase 1 flagellin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337287629|ref|YP_004627101.1|
Sequence length 131
Comment flagellar basal-body rod protein FlgB [Thermodesulfobacterium geofontis OPF15]
Sequence
MLGVFERTFNLVKTALKIRSYKHSLLASNIANVDTPGYRRKDIPFEKIIQSYLSEKNRLK
TTHPKHFDGSFKNINKLLKAYEEETLGTPNNVNLEEELVQLTENQMLYEATLQALSKELE
RLKEAITEGGR
Download sequence
Identical sequences F8C221
WP_013908873.1.95401 gi|337287629|ref|YP_004627101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]