SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337288299|ref|YP_004627771.1| from Thermodesulfobacterium sp. OPB45

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337288299|ref|YP_004627771.1|
Domain Number 1 Region: 11-158
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.37e-37
Family Deoxycytidylate deaminase-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337288299|ref|YP_004627771.1|
Sequence length 187
Comment CMP/dCMP deaminase zinc-binding protein [Thermodesulfobacterium geofontis OPF15]
Sequence
MDDRIYRPNWHEYFMLIAKIVALRSGCNSRPTGAVIVKDKRILATGYNGPMPGAWHCTDK
GSNYCFRREKGVPDIDKYNFCRSTHAEANAIAQAARFGISVEGASIYCTLAPCYVCLKLL
AGAGIKEVYYEYDYESRDFERDEFWKTAIKEAKIEVFKQIRVSEETLKALENILPFPTSK
RRLPPTD
Download sequence
Identical sequences F8C576
gi|337288299|ref|YP_004627771.1| WP_013909543.1.95401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]